Dallas to Austin Movers

Best Dallas to Austin Movers

Want help with the heavy lifting?

Updated August 1, 2025

Looking for reliable Dallas to Austin movers for this 196 mile intrastate move? See our top 5 recommended movers, get estimated moving costs, and read our Dallas to Austin moving guide below. We analyzed 196 Austin to Dallas moving companies across 192,175 review data points and more than 18,000 movers nationwide using our 11-point rating system to bring you data-backed moving recommendations.

Key Takeaways:

  • Phoenix Express Specialty Moving & Delivery is our overall top recommended Dallas to Austin moving company
  • Webster & Company Moving Services is the most affordable company to hire
  • Moving from Dallas to Austin will cost on average between $1,500 - $4,500
  • Our rankings and results are unbiased & backed by data… NOT paid promotions
Dallas to Austin featured image

Best Dallas to Austin Movers

RankCompanyScoreAction
1Phoenix Express Specialty Moving & Delivery9.73
2Einstein Moving Company9.67
3Eagle Movers Inc9.62
4Einstein Moving Company9.62
5Webster & Company Moving Services9.59

Our Top Recommendations

TOP PICK
Phoenix Express Specialty Moving & Delivery featured image

Phoenix Express Specialty Moving & Delivery

Best moving company overall for Dallas to Austin

9.73/10
ExceptionalView details
RUNNER-UP
Einstein Moving Company featured image

Einstein Moving Company

Best for sticking to the quoted price

9.67/10
ExceptionalView details
ALSO GREAT
Eagle Movers Inc featured image

Eagle Movers Inc

Best overall value

9.62/10
ExceptionalView details

Phoenix Express Specialty Moving & Delivery

Exceptional
9.73/10
Created with Highcharts 12.2.0

1327 Chemical St, Dallas, TX, 75207

Phoenix Express Specialty Moving & Delivery featured image

Best moving company overall to hire when moving from Dallas to Austin! Phoenix Express Specialty Moving & Delivery takes the #1 spot for our overall ranking and is the top recommended movers for this route.

Phoenix Express Specialty Moving & Delivery is the number 1 ranked moving service in Dallas, TX with an overall score of 9.73 out of 10. Based on our extensive analysis, this is an Exceptional score and places it in the top 99.95% of all movers in Texas and the top 99.9% of moving companies nationwide. They score better than 195 other Dallas moving companies and better than 1,881 movers in Texas. Phoenix Express Specialty Moving & Delivery is also one of the top 100 movers nationwide (out of more than 18,000 total moving companies).

Our Research

  • Analyzed 600 total reviews
  • Reviewed 5 social profiles and review listings
  • Checked for license verification at TxDMV & FMCSA
  • Crunched 2,173 data points pertaining to the above

11 Point Rating

MetricScorevs NationwidePositive ReviewsNegative ReviewsPositive Score
Quality9.80↑ 18.0%358498.9%
Punctuality9.84↑ 23.3%152199.3%
Affordability9.38↑ 23.9%88396.7%
Communication9.81↑ 32.0%188298.9%
Stick to Prices9.54↑ 60.0%63395.5%
Speed9.86↑ 16.8%176298.9%
Friendliness9.93↑ 13.7%2390100.0%
Will Hire Again9.80↑ 21.8%357498.9%
Professionalism9.89↑ 20.9%252199.6%
Conflict Handling9.28↑ 128.2%31196.9%
Precision & Care9.86↑ 24.4%247199.6%

Recent Phoenix Express Specialty Moving & Delivery Reviews

Quality - 9.80/10

Overall quality of the service provided on moving day.

Recent Customer Praises
recommend Phoenix Express for their service
service was excellent from communication to the move
far superior to 'All My Sons'
great work by movers
experience was good enough to use their service a second time
Recent Customer Complaints
service is subpar and unprofessional
Overall Review Distribution
Positive
358 (98.9%)
Negative
4 (1.1%)

Additional Details

Moving Services Offered by Phoenix Express Specialty Moving & Delivery

  • Full service moving
  • In-Dallas moves
  • In-Texas moves
  • Cross country moves
  • Specialty moving & delivery
  • Packing & loading unpacking & unloading only
  • Residential & commercial moving
  • Large, heavy, or delicate item moving
  • Furniture moving
  • Piano moving

Einstein Moving Company

Exceptional
9.67/10
Created with Highcharts 12.2.0

11884 Greenville Ave Suite 100, Dallas, TX, 75243

Einstein Moving Company featured image

Best movers to hire for honesty and transparency. Einstein Moving Company sticks to their quoted prices better than the rest.

Einstein Moving Company is the number 2 ranked moving service in Dallas, TX with an overall score of 9.67 out of 10. Based on our extensive analysis, this is an Exceptional score and places it in the top 99.89% of all movers in Texas and the top 99.77% of moving companies nationwide. They score better than 194 other Dallas moving companies and better than 1,880 movers in Texas. Einstein Moving Company is also one of the top 100 movers nationwide (out of more than 18,000 total moving companies).

Our Research

  • Analyzed 963 total reviews
  • Reviewed 7 social profiles and review listings
  • Checked for license verification at TxDMV & FMCSA
  • Crunched 4,238 data points pertaining to the above

11 Point Rating

MetricScorevs NationwidePositive ReviewsNegative ReviewsPositive Score
Quality9.77↑ 17.7%7561598.1%
Punctuality9.86↑ 23.6%274299.3%
Affordability9.31↑ 22.9%140596.6%
Communication9.75↑ 31.2%308897.5%
Stick to Prices9.70↑ 62.7%138397.9%
Speed9.89↑ 17.1%431698.6%
Friendliness9.91↑ 13.5%441299.5%
Will Hire Again9.75↑ 21.2%7451797.8%
Professionalism9.84↑ 20.3%449598.9%
Conflict Handling8.80↑ 116.3%50689.3%
Precision & Care9.74↑ 22.9%4271097.7%

Recent Einstein Moving Company Reviews

Quality - 9.77/10

Overall quality of the service provided on moving day.

Recent Customer Praises
Einstein delivers quality service
they are 1,000 times better than competition
awesome experience with movers
great service both times used
Marcus & John helped make our move stress free
Recent Customer Complaints
didn't handle one piece of furniture well
great work by movers
Overall Review Distribution
Positive
756 (98.1%)
Negative
15 (1.9%)

Additional Details

Moving Services Offered by Einstein Moving Company

  • Local moving
  • Long-distance moving
  • Small moving
  • Piano moving
  • Pool table moving
  • Appliance moving
  • Furniture moving
  • Packing services
  • Storage services
  • Commercial moving

Eagle Movers Inc

Exceptional
9.62/10
Created with Highcharts 12.2.0

525 N Ave, Plano, TX, 75074

Eagle Movers Inc featured image

Get the best bang for your buck hiring Eagle Movers Inc of Plano. They have the best affordability index score which measures both quality and affordability.

Eagle Movers Inc is the number 3 ranked moving service in Dallas, TX with an overall score of 9.62 out of 10. Based on our extensive analysis, this is an Exceptional score and places it in the top 99.73% of all movers in Texas and the top 99.54% of moving companies nationwide. They score better than 193 other Dallas moving companies and better than 1,877 movers in Texas. Eagle Movers Inc is also one of the top 100 movers nationwide (out of more than 18,000 total moving companies).

Our Research

  • Analyzed 419 total reviews
  • Reviewed 3 social profiles and review listings
  • Checked for license verification at TxDMV & FMCSA
  • Crunched 778 data points pertaining to the above

11 Point Rating

MetricScorevs NationwidePositive ReviewsNegative ReviewsPositive Score
Quality9.83↑ 18.3%1410100.0%
Punctuality9.73↑ 21.9%520100.0%
Affordability9.61↑ 26.8%340100.0%
Communication9.78↑ 31.5%640100.0%
Stick to Prices9.46↑ 58.6%160100.0%
Speed9.87↑ 16.9%750100.0%
Friendliness9.84↑ 12.7%830100.0%
Will Hire Again9.81↑ 21.9%1390100.0%
Professionalism9.82↑ 20.1%870100.0%
Conflict Handling8.28↑ 103.6%50100.0%
Precision & Care9.84↑ 24.1%820100.0%

Recent Eagle Movers Inc Reviews

Quality - 9.83/10

Overall quality of the service provided on moving day.

Recent Customer Praises
they were amazing
recommend this company and would hire again
couldn't ask for a better experience
Joey at Eagle Movers was super professional
Great experience using Eagle Movers
Recent Customer Complaints
Overall Review Distribution
Positive
141 (100.0%)
Negative
0 (0.0%)

Additional Details

Moving Services Offered by Eagle Movers Inc

  • Local Move
  • Long Distance
  • Storage
  • Packing Supplies
  • Estimate
  • File a Claim
  • Schedule-In-home-estimate
  • Contact Us

Einstein Moving Company

Exceptional
9.62/10
Created with Highcharts 12.2.0

9200 Brown Ln a, Austin, TX, 78754

11-Point Rating

9.7
9.6
9.4
9.7
9.6
9.7
9.8
9.7
9.8
9.0
9.7

Webster & Company Moving Services

Exceptional
9.59/10
Created with Highcharts 12.2.0

Cedar Park, TX

11-Point Rating

9.7
9.6
9.6
9.5
9.7
9.8
9.8
9.8
9.7
8.7
9.6

How Much Do Dallas to Austin Movers Cost?

Moving 196 miles from Dallas, TX to Austin, TX will typically cost between $2,000 and $4,500 to hire full service movers. See the chart below for a detailed breakdown by home size.

  • Expected Range: $2,000 - $4,500
  • Expected Time To Complete: 2-3 days
  • Most Affordable Recommended Movers: Webster & Company Moving Services
HOME SIZEMOVING COSTVOLUME OF PACKED ITEMS (FT3)$/FT3
Studio$1,314300 ft3$4.38
1 Bedroom$1,948450 ft3$4.33
2 Bedrooms$3,209750 ft3$4.28
3 Bedrooms$4,6521100 ft3$4.23
4 Bedrooms$6,6861600 ft3$4.18
5+ Bedrooms$7,4321800 ft3$4.13

Pro tip for the cheapest long distance move

Find long distance movers in Austin that already have a booked job heading from Austin to Dallas. Their moving truck would be making the trip back to Austin from Dallas entirely empty. If you can find a Austin moving company willing to move your stuff on the return leg, you'll score a real deal!

Moving Containers: A cheaper Dallas to Austin moving option

Hire local Dallas movers for the pickup location at an hourly rate. They can quickly load your moving container. When your container is dropped off at your new home, hire Austin movers to unpack the container and move you into your new home. You'll have to piece this Dallas to Austin move together yourself with at least 3 different companies. Taking on this scheduling responsibility will save you a little money by moving with this strategy.

How we ranked the top Dallas to Austin movers

Why you should trust us

We take reviews seriously to protect people just like you! Our team has been crunching data on moving companies since 2010. Our math-based ranking system uses data, manual review, and statistical analysis to help you hire the best Dallas, TX to Austin, TX long distance movers.

Rating Methodology

Here's the methodology we used to come up with the best movers for the Dallas to Austin moving route:

Our data scientist working on the years of experience formula

Our original review-based ranking algorithm

We started with a total of 196 companies that offer interstate moving services in both the Dallas and Austin areas.

From these 196 companies, we analyzed a total of 57,942 reviews dating all the way back to June 2007.

We also reviewed a total of 80 state and federal moving licenses from these 196 companies and 780 different 3rd party review and social profiles.

Each of the ~57,000 reviews was scored according to our detailed 11-point rating criteria

Reviews are time-weighted so that more recent reviews carry more weight. This helps you understand how a mover is doing today... not 5 years ago. We have 18,255 Dallas to Austin moving company data points from the past 2 years that carry more weight.

Bayesian averages calculated to fairly account for the differences between companies that are newer(like Eagle Movers Inc) vs older more established companies (like Webster & Company Moving Services).

The Great Guys Moving 11-Point Rating Breakdown

Our 11-point rating criteria scores every Dallas to Austin moving company across 11 of the most important criteria for a succesful moving experience.

Quality

Overall quality of the service provided on moving day.

8.75/10 avg (Dallas & Austin combined) from 36,995 reviews

Punctuality

Did the crew show up on-time with the required equipment?

8.37/10 avg (Dallas & Austin combined) from 13,345 reviews

Affordability

How affordable was the moving service?

8.03/10 avg (Dallas & Austin combined) from 7,213 reviews

Communication

Responsiveness before, during, and after the move.

7.91/10 avg (Dallas & Austin combined) from 13,029 reviews

Stick to Prices

Was the final price consistent with the original quote?

6.63/10 avg (Dallas & Austin combined) from 3,984 reviews

Speed

Efficiency without taking unnecessary time to increase costs.

8.94/10 avg (Dallas & Austin combined) from 17,645 reviews

Friendliness

Was the moving crew cordial and friendly on moving day?

9.10/10 avg (Dallas & Austin combined) from 20,321 reviews

Will Hire Again

How likely a customer is to hire the same movers again.

8.56/10 avg (Dallas & Austin combined) from 37,509 reviews

Professionalism

Did the moving crew behave professionally on moving day?

8.60/10 avg (Dallas & Austin combined) from 20,884 reviews

Conflict Handling

How well the company responds to accidents and issues.

4.29/10 avg (Dallas & Austin combined) from 3,642 reviews

Precision & Care

Were walls scratched? Did furniture get damaged or lost?

8.44/10 avg (Dallas & Austin combined) from 17,608 reviews

Dallas to Austin Moving Guide

From Dallas to Austin: Comparable Neighborhoods at a Glance

Dallas vs Austin Neighborhood Comparison
DallasAustinHow They're Similar
UptownThe Domainupscale mixed-use area with walkable high-rise living
Deep EllumEast Austinartsy district with live music venues
Bishop Arts DistrictSouth Congressindependent boutiques and trendy cafés
Oak LawnClarksvillehistoric residential feel and LGBTQ-friendly
LakewoodTarrytownfamily-oriented with upscale homes near water
M StreetsHyde Parktree-lined blocks of craftsman bungalows
Lower GreenvilleRainey Streetcasual bar scene with outdoor patios
Knox-HendersonSouth Lamartrendy dining, boutiques and nightlife
East DallasEast Austingentrifying neighborhood with creative vibe
  • Uptown in Dallas & The Domain in Austin are both known for their: upscale mixed-use area with walkable high-rise living
  • Dallas' Deep Ellum neighborhood & Austin's East Austin both share: artsy district with live music venues
  • If you're moving from Bishop Arts District, check out South Congress in the Austin area for the: independent boutiques and trendy cafés
  • Do you enjoy Oak Lawn's historic residential feel and LGBTQ-friendly vibe? You're sure to love Clarksville
  • Move from Lakewood to Tarrytown and continue to enjoy these neighborhood qualities: family-oriented with upscale homes near water
  • M Streets & Hyde Park are both known for their: tree-lined blocks of craftsman bungalows
  • Dallas' Lower Greenville neighborhood & Austin's Rainey Street neighborhood both have: casual bar scene with outdoor patios
  • If you're moving from Knox-Henderson, look into South Lamar for the: trendy dining, boutiques and nightlife
  • Do you cherish living in East Dallas' gentrifying neighborhood with a creative vibe? Move into East Austin for something similar

Pros and Cons of Moving from Dallas to Austin

ConsDallas, TX iconDallas, TX
  • Higher crime rates
  • More corporate
  • Less green spaces
  • Hotter summers
ProsAustin, TX iconAustin, TX
  • Livelier music scene
  • Vibrant arts community
  • More outdoor activities
  • Mild winters

Austin, TX iconAustin, TX
  • Higher living costs
  • Traffic congestion
  • Smaller homes
  • Less parking
Dallas, TX iconDallas, TX
  • Strong job market
  • Vibrant nightlife
  • More dining options
  • Diverse shopping

Pros of moving from Dallas to Austin

  • Say goodbye to higher crime rates and hello to a livelier music scene
  • Look forward to moving away from more corporate environments and moving to Austin with a vibrant arts community
  • Swap the less green spaces of Dallas for more outdoor activities in Austin
  • Get ready for mild winters in Austin

Cons of moving from Dallas to Austin

  • Unfortunately, you'll be moving away from a strong job market in Dallas to live with higher living costs in Austin
  • You'll lose out on the pro of a vibrant nightlife and have to settle with the con of traffic congestion
  • Time to bid farewell to more dining options and get used to smaller homes in Austin
  • Swap diverse shopping for less parking

Dallas vs. Austin: Comparing the Local Foodie Scene

ComparisonDallasAustin
Most iconic local food itemChicken-fried steakBrisket
Most popular meat dishBarbecue ribsTacos al pastor
Most popular street food itemTacosBreakfast tacos
Most popular vegan foodTex-Mex Quinoa SaladBBQ Jackfruit Sandwich
Top 3 iconic restaurants that summarize the city
  • Franklin Barbecue
  • Uchi
  • Launderette
Fitness/Health Conscientiousness💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪💪
Abundance of Food Trucks🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚🚚
Foodie Scene🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴🍴
Vegan Friendly🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱🌱

If you're moving from Dallas to Austin, you will be trading the iconic Chicken-fried steak of Dallas for the equally delicious Brisket of Austin. And while the locals in Dallas rave about their flavorful Barbecue ribs and sumptuous Tacos, Austin residents know they have tasty Tacos al pastor and Breakfast tacos to savor. While the vegan transplants might be saying goodbye to the Tex-Mex Quinoa Salad they've grown to love, they can get ready for the BBQ Jackfruit Sandwich of Austin. In the days before your move, make sure you get one final trip to iconic Dallas eateries like Perry's Steakhouse and Grille, Pappas Bros. Steakhouse, and Nick and Sam's. After the boxes are unpacked in Austin, don't wait too long before making your way to Austin's acclaimed eateries like Franklin Barbecue, Uchi, and Launderette.

When comparing lifestyles, Austin shows a greater emphasis on fitness and health consciousness than Dallas. Food truck fans will discover a greater selection in Austin compared to what you are used to in Dallas. Also, the overall foodie scene is more bustling in Austin.

Discover Austin Restaurants You'll Love

Moving to Austin is an opportunity to try lots of new restaurants. Sure, you'll miss your old Dallas favorites, but we've got you covered. If you loved Uchi, Pecan Lodge, and Tei-An in Dallas, we're sure you'll love Uchi, Franklin Barbecue, and Ramen Tatsu-Ya in Austin. See our Austin restaurant discovery table below to find the closest comparison restaurant to all of your cherished Dallas hotspots. For example, if you enjoyed dining at Rise nº1, head to Chez Zee on your first Friday night after the boxes are unpacked.

DallasAustinWhat You'll Love
UchiUchiThe same upscale Japanese dining experience that you love in Dallas.
Pecan LodgeFranklin BarbecueKnown for their legendary brisket, just like Pecan Lodge.
Tei-AnRamen Tatsu-YaA go-to spot for delicious Japanese noodles.
rise nº1Chez ZeeBoth places offer a unique take on savory and sweet dishes.
JoseFonda San MiguelOffers a vibrant atmosphere and quality Mexican cuisine.
Val's CheesecakesThe Cheesecake ExperienceHandcrafted cheesecakes that rival the Dallas favorite.
CucharaEl AlmaProvides an authentic and artistic Mexican dining experience.
Terry Black's BarbecueTerry Black's BarbecueThe same mouth-watering BBQ experience in Austin.
KnifeJack Allen's KitchenKnown for its expert take on steaks and local cuisine.
RapscallionLaunderetteBoth offer inventive dishes in a trendy setting.

Real Estate & Lifestyle Differences between Dallas and Austin

ComparisonDallasAustin
Typical Architecture StyleRanch and ModernModern and Craftsman
Walkability👟👟👟👟👟👟👟👟👟👟👟👟👟👟👟👟👟👟👟👟
Bikeability🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲🚲
Urban Lifestyle🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️🏛️
Most popular items mentioned in real estate listingSpacious living areas, outdoor poolsEco-friendly features, open floor plans
Dallas
Austin
Nationwide
$621k$621k$496.8k$496.8k$372.6k$372.6k$248.4k$248.4k$124.2k$124.2k0020152015201620162017201720182018201920192020202020212021202220222023202320242024
source: zillow.com
Dallas
Austin
Nationwide
$2k$2k$1.6k$1.6k$1.2k$1.2k8008004004000020152015201620162017201720182018201920192020202020212021202220222023202320242024
source: zillow.com
  • The Ranch and Modern architecture that Dallas is known for will be replaced with the Modern and Craftsman architecture typical of Austin.
  • Compared to Dallas's real estate listings that commonly reference spacious living areas and outdoor pools, Austin real estate listings often highlight features like eco-friendly options and open floor plans.
  • Make sure you unpack those walking shoes. Austin is more walkable than Dallas.
  • Make sure the movers take care of your bike. Austin is more bike-friendly than Dallas.
  • Austin has more of an urban feel than Dallas.
  • Austin housing costs are 73% more expensive than they are in Dallas, with a median home price of $546,619 compared to Dallas’s $316,469.
  • Over the prior 5 years, home prices in Austin have increased by 47% compared to a 47% increase in Dallas.
  • Rent in Austin is 1.17% more expensive than in Dallas.

Pet-friendly Neighborhoods in Austin, TX

  1. South Congress : You're sure to enjoy the abundance of pet-friendly restaurants and businesses that welcome you and your furry friends.
  2. Zilker : The expansive Barton Springs and Zilker Park nearby offer plenty of outdoor space for your pets to run and play.
  3. Mueller : This vibrant neighborhood features many green spaces and trails perfect for leisurely strolls with your pets.

Your Move, Your Forecast: Key Weather Differences between Dallas and Austin

ComparisonDallasAustin
Days of Sunshine per Year☀️☀️☀️☀️☀️☀️☀️☀️☀️☀️
Avg. Annual Humidity💦💦💦💦💦💦💦💦💦💦💦💦💦💦💦💦💦💦💦💦
Avg. UV Index🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️🕶️
Natural DisastersTornadoes, HailFloods, Wildfires
Air QualityModerateGood
Average Summer High/Low (°F)96/7795/74
Average Winter High/Low (°F)57/3762/42
Annual Rainfall (Inches)3934
Annual Snowfall (Inches)10
  • The shades won't be used as much for your move from Dallas to Austin. Austin gets 3% fewer sunshine days than Dallas.
  • Austin has higher humidity and a higher average UV index compared to Dallas.
  • Say goodbye to the possible tornadoes and hail in Dallas, but be on the lookout for potential floods and wildfires in Austin.
  • The average summer high temperature in Austin is 1 degree colder than in Dallas.
  • The average winter lows are 5 degrees warmer than they are in Dallas.
  • Your umbrella might be neglected in Austin. Austin receives 5 fewer inches of rain compared to Dallas.

Financial & Community Snapshot: Dallas and Austin

ComparisonDallasAustin
Avg. Household Income$57,995$79,542
Cost of Living Index91.995.5
State Income Tax0%0%
Avg. Property Tax2.06%1.98%
Avg. Sales Tax8.25%8.25%
Top 3 IndustriesTechnology, Financial Services, DefenseTechnology, Education, Health Services
AffluenceModerately affluentHighly affluent
PovertyModerateLower
HomelessnessConcerningModerate
  • The income in {to_city} is compared to that in {from_city}
  • The cost of living index in {to_city} is compared to that in {from_city}
  • The income tax message is relevant for both cities
  • The affluence in {to_city} is {to_affluence} compared to {from_affluence} in {from_city}
  • The poverty level is {to_poverty} in {to_city} compared to {from_poverty} in {from_city}
  • In terms of homelessness, it is {from_homelessness} in {from_city} and {to_homelessness} in {to_city}

Political and Religious Climate in Dallas vs. Austin

ComparisonDallasAustin
Political Make-upLean LiberalVery Liberal
Local PoliticsDemocratic Majority in City CouncilProgressively Liberal City Council
ReligionDiverse; with First Baptist Church significantLess Religious overall; renowned for First Unitarian Universalist Church
  • Dallas tends to lean Liberal in its political climate
  • Austin, on the other hand, is often described as very Liberal
  • Austin's religious environment can be described as less religious overall and is renowned for the First Unitarian Universalist Church
  • Dallas' residents' religious practices can be generally categorized as diverse and include the significant First Baptist Church

Dallas vs. Austin Traffic and Public Transit Considerations

ComparisonDallasAustin
Avg Commute Time (in minutes)2725
Traffic Congestion🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦🚦
Availability of Public Transit🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇🚇
Can you get by without a car?DifficultChallenging
  • Woohoo! Expect to spend about 7% less time stuck in traffic commuting to work in Austin compared to your daily drive in Dallas. That's an annual savings of 1,040 minutes freely earned!
  • You can expect traffic in Austin to be better than it is in Dallas.
  • Public transit is less readily available in Austin.

Charts & Visualizations

With 192,175 data points across 196 moving companies and 57,942 reviews, we've got a lot of data to work with. Here are some of the charts and visualizations we've created to help you understand the moving industry in Dallas to Austin.

Comparing ratings, review history, and total data points

Bubble size represents the number of analyzed data points. Hover over bubbles for details.

Created with Highcharts 12.2.0Great Guys Moving RatingYears of Review HistoryPESMEMCEMIEMCWCMSWOMMDHSAKMCEMCMMMLRJMCTMDVMSRSMDTMEMSLMCNAHMLNMHMASBOMAIMCBGMHAMLMLWAMCSMCMFMLQMSTSMAAMFMMSMPBTMUMSSMDMPTCMCTOMUMFFMBPMILGMATCMBTMTMESMPMMABBMAM8.88.999.19.29.39.49.59.69.79.80510152025

Ranking history

How the currently ranked top Dallas to Austin movers have performed over time

Created with Highcharts 12.2.0ExceptionalSuperbFabulousVery GoodGoodYearOverall RatingEinstein Moving CompanyPhoenix Express Specialty Moving & DeliveryEinstein Moving CompanyWebster & Company Moving ServicesEagle Movers Inc201220132014201520162017201820192020202120222023202488.599.510

11-Point Rating Comparison

Detailed breakdown of Dallas to Austin moving company 11-point ratings

Created with Highcharts 12.2.011-Point Rating CriteriaCompany9.89.849.389.819.549.869.939.89.899.289.869.779.869.319.759.79.899.919.759.848.89.749.839.739.619.789.469.879.849.819.828.289.849.739.639.419.699.589.699.859.699.899.719.729.649.639.529.669.789.769.759.78.699.6378910QualityPunctualityAffordabilityCommunicationStick to PricesSpeedFriendlinessWill Hire AgainProfessionalismConflict HandlingPrecision & CarePhoenix Express Spec...Einstein Moving Comp...Eagle Movers IncEinstein Moving Comp...Webster & Company Mo...

Statewide 11-Point Percentile Comparison

See how our recommended top movers compare to all movers in Texas & Texas

Quality iconQuality
Punctuality iconPunctuality
Affordability iconAffordability
Communication iconCommunication
Stick to Prices iconStick to Prices
Speed iconSpeed
Friendliness iconFriendliness
Will Hire Again iconWill Hire Again
Professionalism iconProfessionalism
Conflict Handling iconConflict Handling
Precision & Care iconPrecision & Care
Phoenix Express Specialty Moving & Delivery Logo

Phoenix Express Specialty Moving & Delivery

Exceptional9.73
99
100
93
100
99
99
100
99
100
100
100
Einstein Moving Company Logo

Einstein Moving Company

Exceptional9.67
98
100
90
99
100
99
99
99
99
99
99
Eagle Movers Inc Logo

Eagle Movers Inc

Exceptional9.62
99
98
99
100
99
99
96
100
99
98
100
Einstein Moving Company Logo

Einstein Moving Company

Exceptional9.62
96
94
94
99
99
89
96
96
98
100
97
Webster & Company Moving Services Logo

Webster & Company Moving Services

Exceptional9.59
95
94
99
95
100
95
90
98
94
99
95

Percentile Ranking

0
10
20
30
40
50
60
70
80
90
100
*Note: the above data points reflect a moving company's percentile ranking compared to all moving companies in Texas & Texas.

List of All Dallas to Austin Moving Companies Analyzed

  • Elephant Moving and Storage
  • Modern Moves DFW
  • Swift Moves
  • AOA moving services Austin inc.
  • Soleil Moving
  • Morris Moving and Storage LLC Austin
  • MoverTron Moving
  • Haul ATX Moving Company - Austin
  • Easy Moving LLC
  • Moving Mountains Texas LLC
  • Green Leaf Moving
  • MoveCorp
  • Valet Moving Services - Round Rock Movers
  • Dallas Moving Forward
  • Suite Movers
  • Alliance Relocation Services
  • Later Neighbor Moving
  • CratingPro Moving
  • Joe Mommas Moving Company
  • Move Team Texas
  • Texas Sized Moving- Austin
  • Amen Moving
  • Bam Bam Moving and Piano Experts LLC
  • Pack Man Moving ATX LLC
  • River City Structural Movers
  • The G.O.A.T. Movers, LLC.
  • Collegeboxes at U-Haul Moving & Storage at I-35 and Airport Blvd
  • Box Ox Moving Company
  • The Muscle Moving Company
  • Patriot Relocation Company
  • Common Sense Moving Company
  • Hawk Movers, LLC
  • Tetris Moving
  • Maid for Moving LLC
  • Element Moving & Wine Storage
  • 1Source Moving
  • Arranging It All
  • Dros Moving Pros
  • North American Van Lines
  • R & J Moving Co LLC
  • Avancé Moving & Storage
  • A Kings Sons Moving Company
  • R & K Moving Company LLC
  • DTM Van Lines
  • Tetris Master Movers and Transportation LLC
  • Blue Ribbon Moving & Storage
  • NorthStar Moving Company
  • Expert Relocation Systems
  • Allied Van Lines
  • White Glove Storage & Delivery
  • Move and Care LLC
  • Moving Company Guys - Dallas
  • North American Van Lines
  • Abel's Fine Furniture Movers
  • Smooth Moves by Design
  • DFW Packing Pros
  • Movers of Austin
  • Piano Wrangler
  • Limestone Moving Co.
  • Black Tie Moving
  • BEST PRICE MOVERS Inc
  • Dependable Hauling Solutions,Moving and Junk removal.
  • Planet Moving & Storage
  • SpaceMan Moving
  • Quality Moving & Storage
  • Muscle Delivery & Moving
  • TetrisPro Movers - Dallas
  • White Glove Storage & Delivery
  • Tech City Moving Company
  • Take Off Moving
  • Main Street Moving
  • Texan Moving and Storage
  • Rish Elite Moving, LLC
  • 2 Fellas Moving Company
  • Progressive Moving
  • Bolt Movers
  • West Austin Moving
  • Next Destination Moving
  • Movers League
  • Flat Price Moving and Auto Shipping
  • Rapimove - Furniture Moving & Delivery
  • Jackson's Moving and Delivery
  • Piece by Peace Moving Company
  • Not a Hobby Moving - Austin Movers
  • Undergrads Moving
  • Greater Austin Moving & Storage
  • Austin Moving Forward
  • Hercules Movers & Packers - DFW
  • MI-BOX Moving & Mobile Storage of Dallas
  • Buddy Moving
  • Bradfield Piano Restoration, Moving and Storage, LLC
  • Eagle Movers Inc
  • Undergrads Moving
  • Norco Moving & Storage
  • Best Movers Dallas
  • Ang Moving Co
  • Imlach & Collins Brothers, LLC
  • Monarca Movers Dallas
  • Move Solutions LLC - Best Office Movers
  • Big Gunz Movers & Home Improvement LLC
  • MoveWorks, Inc.
  • A Plus Texas Movers
  • Move Solutions Ltd - Austin
  • Fast Fietz Moving
  • Elite Star Movers
  • Johnson Storage & Moving
  • Seraphimmoving
  • Finesse Movers
  • Pro Movers Plus Lakeway
  • Olympic Moving
  • Webster & Company Moving Services
  • C&L Movers
  • Melrose Movers and Storage
  • Black Ops Moving and Delivery
  • Antz Movers
  • Ironman Moving
  • Hot Shot Moving and Delivery
  • AB Moving
  • Texas Movers Now
  • Dependable RELO
  • Ward North American
  • Infinity Moving Company
  • The Official Moving Company
  • Texan Tuff Movers
  • House N Box Movers
  • Leon Moving LLC
  • Capital Movers Texas
  • State To State Move
  • Brother Bear Moving
  • Lion Heart Movers of Frisco
  • Ap Moving Services
  • Expert City Movers
  • A-1 Freeman Moving Group
  • Atlantic Relocation Systems
  • Evolution Moving Company
  • Metro Moving Company LLC
  • Ward North American
  • STI Movers Dallas TX
  • Abundant Moving
  • Around The Block Moving
  • Stonebriar Movers
  • AB Moving Company
  • Reliant Moving Services
  • Policeman Mover LLC
  • Berger Allied Moving & Storage
  • Midnight Hour Moving
  • Austin Affordable Moving
  • Olympia Moving & Storage
  • Word of Mouth Moving
  • Apple Moving
  • U-Pack
  • Sarver Movers
  • Berger Allied Moving & Storage
  • MASH Movers
  • Central Transportation Systems
  • Simpler Moving & Packing
  • Elephant Moving and Storage
  • Heavenly Moving and Storage
  • Little Guys Movers
  • Unicorn Moving & Storage
  • Square Cow Movers & Storage Austin
  • Blue Whale Moving Company
  • Daryl Flood Relocation & Logistics
  • 3 Men Movers - Austin
  • Muscleman Elite Moving & Storage
  • Bellhop Moving
  • Two Men and a Truck
  • Einstein Moving Company
  • DFW Moving Company, LLC
  • 1st Generation Moving
  • U-Pack
  • 5 Star Movers
  • ABC Movers Dallas
  • Progressive Moving
  • King Moving Company
  • Phoenix Express Specialty Moving & Delivery
  • Minute Man Moving
  • Puma Van Lines
  • Around the Clock Moving & Storage
  • Big Tex Moving
  • Delicate Moving
  • Two Men and a Truck
  • Fantastic Moves
  • Dallas Moving Inc
  • Einstein Moving Company
  • North Dallas Moving and Storage
  • Same Day Small Movers
  • Mustang Moving
  • AM Moving Company
  • 3 Men Movers - Dallas
  • Exodus Moving & Storage, LLC.
  • Bellhop Moving
  • Wrightway Moving Company LLC
  • Wildcat Movers - Dallas
  • The Move Place
  • Black Tie Moving